PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11305.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 213aa    MW: 22867.2 Da    PI: 8.684
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11305.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-391878262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++l+cprC+s+ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rk  k+s
  KHN11305.1 18 EQEQLQCPRCNSNNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGSRKTTKRS 78
                57899***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-261470IPR003851Zinc finger, Dof-type
PfamPF027015.7E-332076IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2552276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MQDPTIFPGV KPPPHFPEQE QLQCPRCNSN NTKFCYYNNY NLSQPRHFCK NCRRYWTKGG  60
ALRNIPVGGG SRKTTKRSSS TSKRSSAPSS SSSAVSEPDP TRNCTNPVDQ DQRVLNIGGG  120
SFSSLLASSG HFGTLLEGLN PTGSSLKMGE FGEGVSSDPG LNLVSGQNPG LQVQSTNGRS  180
ESFLGLQNGD SSCWNGTHGW SDLAIYTPGP SFQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2359040.0AC235904.2 Glycine max clone GM_WBc0179J02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585530.11e-154PREDICTED: dof zinc finger protein DOF3.1
SwissprotO821552e-42DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A0B2PQH41e-155A0A0B2PQH4_GLYSO; Dof zinc finger protein DOF1.7
STRINGGLYMA08G20840.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61813351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-36DOF zinc finger protein 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]